PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00590g33005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family M-type_MADS
Protein Properties Length: 185aa    MW: 21348.4 Da    PI: 9.1305
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00590g33005.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF44.91.4e-141663249
                              ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
                    SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                              +i+n+  r+++f+kRr ++ K A+EL + C++++ +i+fs+++k + +
  Peinf101Scf00590g33005.1 16 KIQNEVDRYTSFCKRRSTLYKAASELAIQCNVDIGIILFSPKNKPFSF 63
                              599***************************************996666 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004329.2E-18766IPR002100Transcription factor, MADS-box
PROSITE profilePS5006619.007767IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.03E-20878IPR002100Transcription factor, MADS-box
PRINTSPR004043.4E-11929IPR002100Transcription factor, MADS-box
PfamPF003193.7E-181663IPR002100Transcription factor, MADS-box
PRINTSPR004043.4E-112944IPR002100Transcription factor, MADS-box
PRINTSPR004043.4E-114465IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 185 aa     Download sequence    Send to blast
MEDKKTKGRQ KIPMVKIQNE VDRYTSFCKR RSTLYKAASE LAIQCNVDIG IILFSPKNKP  60
FSFIHPTVES VIDRFLDPHA QLSESTRLVA AYARNKVNDL NRKTKELDKI EEATNKQAHA  120
YEKMENVCHK GWWESIEHLN EDEIMKLEAW LKATTFNMDR RLKQLKNEAS TSAPLGDAHN  180
APSPF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016474013.12e-71PREDICTED: agamous-like MADS-box protein AGL61
TrEMBLM1DM881e-59M1DM88_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000912774e-59(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA38220138
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.12e-28AGAMOUS-like 61